CCT3 Antikörper (C-Term)

Produktnummer ABIN4886513

Produktdetails anti-CCT3 Antikörper

Target: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Bindungsspezifität: AA 497-536, C-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CCT3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Verwendungszweck: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.

Sequenz: EPLAVKLQTY KTAVETAVLL LRIDDIVSGH KKKGDDQSRQ

Kreuzreaktivität (Details): No cross reactivity with other proteins.

Produktmerkmale: Rabbit IgG polyclonal antibody for T-complex protein 1 subunit gamma(CCT3) detection. Tested with WB in Human,Rat.
Gene Name: chaperonin containing TCP1 subunit 3
Protein Name: T-complex protein 1 subunit gamma

Aufreinigung: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the C-terminus of human CCT3 (497-536aa EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ), different from the related mouse and rat sequences by one amino acid.

Isotyp: IgG

Anwendungsinformationen

Applikationshinweise: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Kommentare:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Konzentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Konservierungsmittel: Sodium azide

Vorsichtsmaßnahmen: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handhabung: Avoid repeated freezing and thawing.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Details zu CCT3

Target: CCT3 (Chaperonin Containing TCP1, Subunit 3 (Gamma) (CCT3))

Andere Bezeichnung: CCT3 (CCT3 Produkte)

Synonyme: chunp6930 antikoerper, wu:fb13f04 antikoerper, wu:fb52a02 antikoerper, wu:fj48b06 antikoerper, NV18778 antikoerper, CCT-gamma antikoerper, CCTG antikoerper, PIG48 antikoerper, TCP-1-gamma antikoerper, TRIC5 antikoerper, AL024092 antikoerper, Cctg antikoerper, Tcp1-rs3 antikoerper, TriC-P5 antikoerper, chaperonin containing TCP1, subunit 3 (gamma) antikoerper, T-complex protein 1 subunit gamma antikoerper, chaperonin containing TCP1 subunit 3 L homeolog antikoerper, chaperonin containing TCP1 subunit 3 antikoerper, chaperonin containing Tcp1, subunit 3 (gamma) antikoerper, cct3 antikoerper, CC1G_11423 antikoerper, Cctgamma antikoerper, tcpg antikoerper, cct3.L antikoerper, CCT3 antikoerper, Cct3 antikoerper

Hintergrund: T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Synonyms: CCT 3 | CCT3 | CCT gamma | CCT-gamma | CCTG | CCT G | hTRiC5 | PIG48 | TCP 1 gamma | TCP-1-gamma | TRIC5 | P49368

Gen-ID: 7203

UniProt: P49368