AMHR2 Antikörper (C-Term)
-
- Target Alle AMHR2 Antikörper anzeigen
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
-
Bindungsspezifität
- AA 384-419, C-Term
-
Reaktivität
- Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser AMHR2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Verwendungszweck
- Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
- Sequenz
- QRYMAPELLD KTLDLQDWGM ALRRADIYSL ALLLWE
- Kreuzreaktivität (Details)
- No cross reactivity with other proteins.
- Produktmerkmale
-
Rabbit IgG polyclonal antibody for Anti-Muellerian hormone type-2 receptor(AMHR2) detection. Tested with WB in Human,Rat.
Gene Name: anti-Mullerian hormone receptor type 2
Protein Name: Anti-Muellerian hormone type-2 receptor - Aufreinigung
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the C-terminus of human AMHR2 (384-419aa QRYMAPELLDKTLDLQDWGMALRRADIYSLALLLWE), different from the related mouse and rat sequences by three amino acids.
- Isotyp
- IgG
- Top Product
- Discover our top product AMHR2 Primärantikörper
-
-
- Applikationshinweise
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Kommentare
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Konzentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Konservierungsmittel
- Sodium azide
- Vorsichtsmaßnahmen
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handhabung
- Avoid repeated freezing and thawing.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- AMHR2 (Anti-Mullerian Hormone Receptor, Type II (AMHR2))
- Andere Bezeichnung
- AMHR2 (AMHR2 Produkte)
- Synonyme
- AMHR antikoerper, MISR2 antikoerper, MISRII antikoerper, MRII antikoerper, Misiir antikoerper, Misrii antikoerper, Mrii antikoerper, anti-Mullerian hormone receptor type 2 antikoerper, anti-Mullerian hormone type 2 receptor antikoerper, AMHR2 antikoerper, Amhr2 antikoerper
- Substanzklasse
- Antibody
- Hintergrund
-
AMHR2 is the receptor for the anti-Mullerian hormone (AMH) which, in addition to testosterone, results in male sex differentiation. AMH and testosterone are produced in the testes by different cells and have different effects. Testosterone promotes the development of male genitalia while the binding of AMH to the encoded receptor prevents the development of the mullerian ducts into uterus and Fallopian tubes. Mutations in this gene are associated with persistent Mullerian duct syndrome type II. Alternatively spliced transcript variants encoding different isoforms have been identified.
Synonyms: AMH | AMH type II receptor | AMHR | AMHR2 | MIS type II receptor | MISR2 | MISRII | MRII | Q16671 - Gen-ID
- 269
- UniProt
- Q16671
-