TRIOBP Antikörper (TRIO and F-Actin Binding Protein)

Details for Product anti-TRIOBP Antibody No. ABIN4362544, Anbieter: Anmelden zum Anzeigen
Antigen
  • tara
  • DFNB28
  • TARA
  • dJ37E16.4
  • AI428493
  • EST478828
  • Tara
  • mKIAA1662
  • TRIO and F-actin binding protein
  • TRIO and F-actin-binding protein
  • TRIO and F-actin binding protein L homeolog
  • TRIO and F-actin binding protein-like
  • TRIOBP
  • LOC100354753
  • triobp.L
  • TRIOBPL
  • Triobp
Reaktivität
Human, Maus, Ratte (Rattus)
25
9
8
3
3
3
3
2
1
1
1
Wirt
Kaninchen
19
6
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
23
11
4
4
3
3
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ATDSRTPEVPAGEGPRRGLGAPLTEDQQNRLSEEIEKKWQELEKLPLRENKRVPLTALLNQSRGERRGPPSDGHEALEKEVQALRAQLEAWRLQGEAPQSA
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung TRIOBP (TRIOBP Antibody Abstract)
Hintergrund Gene Symbol: TRIOBP
Gen-ID 11078
Pathways Regulation of Actin Filament Polymerization
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200-1:500For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-TRIO and F-Actin Binding Protein (TRIOBP) antibody (ABIN4362544) Western Blot: TRIOBP Antibody - Analysis in mouse cell line NIH-3T3 and rat cell lin...
Western Blotting (WB) image for anti-TRIO and F-Actin Binding Protein (TRIOBP) antibody (ABIN4362544) Western Blot: TRIOBP Antibody - Analysis in human cell line U-87 MG.
Haben Sie etwas anderes gesucht?