s100b Antikörper (S100 Calcium Binding Protein B)

Details for Product anti-S100B Antibody No. ABIN4351813, Anbieter: Anmelden zum Anzeigen
Antigen
  • AI266795
  • S100
  • S100a
  • NEF
  • S100-B
  • S100beta
  • S100P
  • AI850290
  • Bpb
  • S100 calcium binding protein A1
  • S100 calcium binding protein B
  • S100 protein, beta polypeptide, neural
  • S100a1
  • S100B
  • S100b
Reaktivität
Human, Maus
447
262
226
203
44
32
8
2
2
1
1
1
1
1
Wirt
Kaninchen
295
184
8
4
3
Klonalität
Polyklonal
Konjugat
Dieser s100b Antikörper ist unkonjugiert
33
27
16
13
13
12
11
10
10
10
10
10
10
10
10
9
6
4
4
3
3
2
1
1
1
1
1
1
1
1
1
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
362
237
221
202
183
177
130
24
13
13
9
7
5
5
4
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung S100B (S100B Antibody Abstract)
Hintergrund Gene Symbol: S100B
Gen-ID 6285
Pathways Regulation of Muscle Cell Differentiation, Positive Regulation of Immune Effector Process, Toll-Like Receptors Cascades, Regulation of long-term Neuronal Synaptic Plasticity
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:1000-1:2500This antibody is useful for Immunohistochemistry-Paraffin and Western Blot. For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunohistochemistry-Paraffin: S100B Antibody [NBP1-87102] - Immunohistochemical stai...
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 100, 70, 5...
Immunofluorescence (IF) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunocytochemistry/Immunofluorescence: S100B Antibody [NBP1-87102] - Staining of hum...
Western Blotting (WB) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Western Blot: S100B Antibody [NBP1-87102] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-S100 Calcium Binding Protein B (S100B) antibody (ABIN4351813) Immunohistochemistry-Paraffin: S100B Antibody - Staining of human cerebral cortex sh...
Produkt verwendet in: Zhou, Cui, Su, Wang, Guo: "Beneficial reciprocal effects of bone marrow stromal cells and Schwann cells from adult rats in a dynamic co‑culture system in vitro without intercellular contact." in: Molecular medicine reports, Vol. 12, Issue 4, pp. 4931-8, 2015 (PubMed). Weitere Details: Immunocytochemistry,Immunofluorescence

Darcy, Trouche, Jin, Feig: "Age-dependent role for Ras-GRF1 in the late stages of adult neurogenesis in the dentate gyrus." in: Hippocampus, Vol. 24, Issue 3, pp. 315-25, 2014 (PubMed). (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunohistochemistry

Kielar, Tuy, Bizzotto, Lebrand, de Juan Romero, Poirier, Oegema, Mancini, Bahi-Buisson, Olaso, Le Moing, Boutourlinsky, Boucher, Carpentier, Berquin, Deleuze, Belvindrah, Borrell, Welker, Chelly et al.: "Mutations in Eml1 lead to ectopic progenitors and neuronal heterotopia in mouse and human. ..." in: Nature neuroscience, Vol. 17, Issue 7, pp. 923-33, 2014 (PubMed).

Hanson, Fregoso, Vrana, Tucker, Niswander: "Peripheral nervous system defects in a mouse model for peroxisomal biogenesis disorders." in: Developmental biology, Vol. 395, Issue 1, pp. 84-95, 2014 (PubMed). (Probematerial (Species): Mouse (Murine)). Weitere Details: Immunohistochemistry

Uhlén, Oksvold, Älgenäs, Hamsten, Fagerberg, Klevebring, Lundberg, Odeberg, Pontén, Kondo, Sivertsson: "Antibody-based protein profiling of the human chromosome 21." in: Molecular & cellular proteomics : MCP, Vol. 11, Issue 3, pp. M111.013458, 2012 (PubMed).

Chaichana, Guerrero-Cazares, Capilla-Gonzalez, Zamora-Berridi, Achanta, Gonzalez-Perez, Jallo, Garcia-Verdugo, Quiñones-Hinojosa: "Intra-operatively obtained human tissue: protocols and techniques for the study of neural stem cells." in: Journal of neuroscience methods, Vol. 180, Issue 1, pp. 116-25, 2009 (PubMed).

Haben Sie etwas anderes gesucht?