RUFY3 Antikörper (RUN and FYVE Domain Containing 3)

Details for Product anti-RUFY3 Antibody No. ABIN4350613, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC81942
  • RUFY3
  • im:7148884
  • wu:fj64d11
  • zgc:110543
  • ripx
  • singar1
  • MGC145963
  • 2810409M01Rik
  • Mem2
  • ZFYVE7
  • RIPX
  • SINGAR1
  • 2810428M05Rik
  • 6330416M07Rik
  • AW455998
  • AW538594
  • D5Bwg0860e
  • Ripx
  • Rpipx
  • mKIAA0871
  • Singar1
  • RUN and FYVE domain containing 3
  • FYVE and coiled-coil domain containing 1
  • RUFY3
  • rufy3
  • LOC100356993
  • Fyco1
  • Rufy3
Reaktivität
Human
10
7
6
5
4
3
2
2
2
1
1
1
1
Wirt
Kaninchen
8
2
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Western Blotting (WB)
10
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:MSALTPPTDMPTPTTDKITQAAMETIYLCKFRVSMDGEWLCLRELDDISLTPDPEPTHEDPNYLMANERMNLMNMAKLSIKGL
Isotyp IgG
Reinigung Immunogen affinity purified
Andere Bezeichnung RIPX (RUFY3 Antibody Abstract)
Hintergrund Gene Symbol: RUFY3
Gen-ID 22902
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-RUN and FYVE Domain Containing 3 (RUFY3) antibody (ABIN4350613) Western Blot: RIPX Antibody [NBP2-48558] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunohistochemistry (IHC) image for anti-RUN and FYVE Domain Containing 3 (RUFY3) antibody (ABIN4350613) Immunohistochemistry: RIPX Antibody [NBP2-48558] - Staining of human cerebral cortex ...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-RUN and FYVE Domain Containing 3 (RUFY3) antibody (ABIN4350613) Immunohistochemistry-Paraffin: RIPX Antibody - Staining of human hippocampus shows m...
Haben Sie etwas anderes gesucht?