RAC3 Antikörper (Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3))

Details for Product anti-RAC3 Antibody No. ABIN4349055, Anbieter: Anmelden zum Anzeigen
Antigen
  • Rac1B
  • rac3
  • zgc:100831
  • RAS-related C3 botulinum substrate 3
  • ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3)
  • ras-related C3 botulinum toxin substrate 3a (rho family, small GTP binding protein Rac3)
  • Rac3
  • RAC3
  • rac3a
Reaktivität
Human
11
7
7
Wirt
Kaninchen
11
Klonalität
Polyklonal
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
11
8
4
4
3
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: TKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREI
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung RAC3 (RAC3 Antibody Abstract)
Hintergrund Gene Symbol: RAC3
Gen-ID 5881
UniProt P60763
Pathways RTK Signalweg, VEGF Signaling
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) antibody (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - liver cancer
Western Blotting (WB) image for anti-Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) antibody (ABIN4349055) Western Blot: RAC3 Antibody [NBP2-32058] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55,...
Immunohistochemistry (IHC) image for anti-Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) antibody (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - Immunohistochemical staining of hu...
Immunohistochemistry (IHC) image for anti-Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) antibody (ABIN4349055) Immunohistochemistry: RAC3 Antibody [NBP2-32058] - skin
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Ras-Related C3 Botulinum Toxin Substrate 3 (Rho Family, Small GTP Binding Protein Rac3) (RAC3) antibody (ABIN4349055) Immunohistochemistry-Paraffin: RAC3 Antibody - Staining of human esophagus shows str...
Haben Sie etwas anderes gesucht?