PDPK1 Antikörper (3-phosphoinositide Dependent Protein Kinase-1)

Details for Product anti-PDPK1 Antibody No. ABIN4344572, Anbieter: Anmelden zum Anzeigen
Antigen
  • pdpk1
  • MGC82080
  • PDK1
  • PDPK2
  • PRO0461
  • Pdk1
  • si:zfos-979f1.3
  • 1210
  • BG02759
  • CG1201
  • CG1210
  • DSTPK61
  • Dmel\\CG1210
  • Dstpk61
  • PDK
  • PDK-1
  • PDK1/Pk61C
  • PK61C
  • Pk61C
  • Pk61C/PDK1
  • dPDK-1
  • dPDK1
  • dSTPK61
  • pk61c
  • 3'-phosphoinositide-dependent protein kinase 1
  • 3-PHOSPHOINOSITIDE-DEPENDENT PROTEIN KINASE 1
  • ATPDK1
  • AtPDK1
  • T32M21.110
  • T32M21_110
  • 3-phosphoinositide dependent protein kinase 1
  • 3-phosphoinositide dependent protein kinase 1 L homeolog
  • 3-phosphoinositide dependent protein kinase-1
  • 3-phosphoinositide-dependent protein kinase 1
  • pyruvate dehydrogenase kinase, isozyme 1
  • pyruvate dehydrogenase kinase 1
  • Phosphoinositide-dependent kinase 1
  • 3'-phosphoinositide-dependent protein kinase 1
  • PDPK1
  • pdpk1.L
  • pdpk1
  • Pdpk1
  • LOC100380750
  • pdk1
  • PDK1
  • Pdk1
  • pdk-1
Reaktivität
Human
462
219
219
19
13
12
11
11
6
5
4
3
2
1
1
1
1
1
1
1
Wirt
Kaninchen
381
73
16
Klonalität
Polyklonal
Konjugat
Dieser PDPK1 Antikörper ist unkonjugiert
19
17
16
11
11
7
7
7
7
7
7
7
7
7
7
6
5
5
4
4
3
3
3
2
2
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
311
158
99
91
66
64
40
31
22
10
7
5
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KEISLLPDNLLRTPSVQLVQSWYIQSLQELLDFKDKSAEDAKAIYDFTDTVIRIRNRHND
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung PDK-1 (PDPK1 Antibody Abstract)
Hintergrund Gene Symbol: PDK1
Molekulargewicht Theoretical MW: 49 kDa
Gen-ID 5163
UniProt Q15118
Pathways PI3K-Akt Signalweg, T-Zell Rezeptor Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Cell-Cell Junction Organization, Regulation of Cell Size, Skeletal Muscle Fiber Development, CXCR4-mediated Signaling Events, Signaling Events mediated by VEGFR1 and VEGFR2, VEGFR1 Specific Signals
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-3-phosphoinositide Dependent Protein Kinase-1 (PDPK1) antibody (ABIN4344572) Immunohistochemistry-Paraffin: PDK-1 Antibody [NBP1-85955] - Staining of human kidney...
Western Blotting (WB) image for anti-3-phosphoinositide Dependent Protein Kinase-1 (PDPK1) antibody (ABIN4344572) Western Blot: PDK-1 Antibody [NBP1-85955] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Produkt verwendet in: Fack, Espedal, Keunen, Golebiewska, Obad, Harter, Mittelbronn, Bähr, Weyerbrock, Stuhr, Miletic, Sakariassen, Stieber, Rygh, Lund-Johansen, Zheng, Gottlieb, Niclou, Bjerkvig: "Bevacizumab treatment induces metabolic adaptation toward anaerobic metabolism in glioblastomas." in: Acta neuropathologica, Vol. 129, Issue 1, pp. 115-31, 2015 (PubMed). (Probematerial (Species): Human). Weitere Details: Western Blotting

Haben Sie etwas anderes gesucht?