MOCOS Antikörper (Molybdenum Cofactor Sulfurase)

Details for Product anti-MOCOS Antibody No. ABIN4335161, Anbieter: Anmelden zum Anzeigen
Antigen
  • HMCS
  • MCS
  • MOS
  • 1110018O12Rik
  • ABA DEFICIENT 3
  • ACI2
  • ALTERED CHLOROPLAST IMPORT 2
  • ATABA3
  • F19K19.13
  • F19K19_13
  • LOS5
  • LOW OSMOTIC STRESS 5
  • MOLYBDENUM COFACTOR SULFURASE
  • SIR3
  • SIRTINOL RESISTANT 3
  • DDBDRAFT_0217046
  • DDBDRAFT_0252757
  • DDB_0217046
  • DDB_0252757
  • Og
  • im:7142948
  • mocos
  • molybdenum cofactor sulfurase
  • molybdenum cofactor sulfurase (LOS5) (ABA3)
  • MOCOS
  • Mocos
  • ABA3
  • AOR_1_1090144
  • mocos
  • MCYG_05594
  • VDBG_04857
  • MGYG_02684
  • TERG_06775
  • mal
Reaktivität
Human, Maus
9
4
3
Wirt
Kaninchen
8
1
Klonalität
Polyklonal
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
8
5
4
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: NQGLLYDRSWMVVNHNGVCLSQKQEPRLCLIQPFIDLRQRIMVIKAKGME PIEVPLEENSERTQIRQSRVCADRVSTYDCGEKISSWLSTFFGRPCHLIK QSSNSQRNAKKK
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung MOCOS (MOCOS Antibody Abstract)
Hintergrund Gene Symbol: MOCOS
Gen-ID 55034
Pathways Response to Water Deprivation, ER-Nucleus Signaling
Applikationshinweise Western Blot 1:250 - 1:500, Simple Western 1:30, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50 - 1:200This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH 6 antigen retrieval is recommended. Use in Immunocytochemistry/immunofluorescence reported in scientific literature (PMID 26239292). In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Western Blot: MOCOS Antibody [NBP2-14243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunohistochemistry-Paraffin: MOCOS Antibody [NBP2-14243] - Staining of human stomac...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Simple Western lane view shows a specif...
Simple Western (SimWes) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Simple Western: MOCOS Antibody [NBP2-14243] - Electropherogram image(s) of correspond...
Immunofluorescence (IF) image for anti-Molybdenum Cofactor Sulfurase (MOCOS) antibody (ABIN4335161) Immunocytochemistry/Immunofluorescence: MOCOS Antibody - Immunofluorescent staining ...
Produkt verwendet in: Féron, Gepner, Lacassagne, Stephan, Mesnage, Blanchard, Boulanger, Tardif, Devèze, Rousseau, Suzuki, Izpisua Belmonte, Khrestchatisky, Nivet, Erard-Garcia: "Olfactory stem cells reveal MOCOS as a new player in autism spectrum disorders." in: Molecular psychiatry, Vol. 21, Issue 9, pp. 1215-24, 2016 (PubMed). Weitere Details: Immunocytochemistry,Western Blotting,Immunofluorescence,Immunohistochemistry

Haben Sie etwas anderes gesucht?