LMAN1 Antikörper (Lectin, Mannose-Binding, 1)

Details for Product anti-LMAN1 Antibody No. ABIN4331216, Anbieter: Anmelden zum Anzeigen
Antigen
  • LMAN1
  • cpx-iii
  • cpxiii
  • lman1
  • wu:fc54c09
  • wu:fi36e01
  • Xp58
  • lman1-a
  • p58
  • ERGIC-53
  • ERGIC53
  • F5F8D
  • FMFD1
  • MCFD1
  • MR60
  • gp58
  • 2610020P13Rik
  • AI326273
  • AU043785
  • C730041J05
  • P58
  • lectin, mannose-binding, 1
  • complexin 3
  • LMAN1
  • cplx3
  • lman1
  • Lman1
Reaktivität
Human
39
21
18
13
9
4
3
3
3
3
2
2
1
1
Wirt
Kaninchen
22
15
2
Klonalität
Polyklonal
Konjugat
Dieser LMAN1 Antikörper ist unkonjugiert
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
34
10
9
8
7
7
3
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung LMAN1 (LMAN1 Antibody Abstract)
Hintergrund Gene Symbol: LMAN1
Gen-ID 3998
Forschungsgebiet Signaling
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Lectin, Mannose-Binding, 1 (LMAN1) antibody (ABIN4331216) Immunohistochemistry-Paraffin: LMAN1 Antibody [NBP1-84812] - Staining of human duoden...
Western Blotting (WB) image for anti-Lectin, Mannose-Binding, 1 (LMAN1) antibody (ABIN4331216) Western Blot: LMAN1 Antibody [NBP1-84812] - Lane 1: Marker [kDa] 230, 110, 82, 49, 32...
Produkt verwendet in: Roeckel, Woerner, Kloor, Yuan, Patsos, Gromes, Kopitz, Gebert: "High frequency of LMAN1 abnormalities in colorectal tumors with microsatellite instability." in: Cancer research, Vol. 69, Issue 1, pp. 292-9, 2009 (PubMed).

Haben Sie etwas anderes gesucht?