HYAL1 Antikörper (Hyaluronidase-1)

Details for Product anti-HYAL1 Antibody No. ABIN4320742, Anbieter: Anmelden zum Anzeigen
Antigen
  • HYAL-1
  • LUCA1
  • NAT6
  • Hya1
  • Hyal-1
  • hyaluronoglucosaminidase 1
  • HYAL1
  • Hyal1
Alternativen
anti-Human HYAL1 Antikörper für ELISA
Reaktivität
Human
76
40
28
7
5
4
4
3
2
2
1
1
1
Wirt
Kaninchen
82
23
8
Klonalität
Polyklonal
Konjugat
Dieser HYAL1 Antikörper ist unkonjugiert
8
8
5
4
4
4
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
71
53
37
16
13
7
6
3
3
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SRALVQAQHPDWPAPQVEAVAQDQFQGAARAWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSRALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHF
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung Hyaluronidase 1/HYAL1 (HYAL1 Antibody Abstract)
Hintergrund Gene Symbol: HYAL1
Gen-ID 3373
Pathways Glycosaminoglycan Metabolic Process
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-HYAL1 Antikörper (Hyaluronidase-1) (ABIN4320742) Western Blot: HYAL1 Antibody [NBP1-83409] - Lane 1: Marker [kDa] 220, 112, 84, 47, 32...
Immunofluorescence (IF) image for anti-HYAL1 Antikörper (Hyaluronidase-1) (ABIN4320742) Immunocytochemistry/Immunofluorescence: HYAL1 Antibody [NBP1-83409] - Staining of hum...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-HYAL1 Antikörper (Hyaluronidase-1) (ABIN4320742) Immunohistochemistry-Paraffin: HYAL1 Antibody [NBP1-83409] - Staining of human corpus...
Produkt verwendet in: Rizzardi, Rosener, Koopmeiners, Isaksson Vogel, Metzger, Forster, Marston, Tiffany, McCarthy, Turley, Warlick, Henriksen, Schmechel: "Evaluation of protein biomarkers of prostate cancer aggressiveness." in: BMC cancer, Vol. 14, pp. 244, 2014 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Siiskonen, Poukka, Tyynelä-Korhonen, Sironen, Pasonen-Seppänen: "Inverse expression of hyaluronidase 2 and hyaluronan synthases 1-3 is associated with reduced hyaluronan content in malignant cutaneous melanoma." in: BMC cancer, Vol. 13, pp. 181, 2013 (PubMed).