FGF1 Antikörper (Fibroblast Growth Factor 1 (Acidic))

Details for Product anti-FGF1 Antibody No. ABIN4311439, Anbieter: Anmelden zum Anzeigen
  • AFGF
  • ECGF
  • ECGF-beta
  • FGF-1
  • FGF-alpha
  • FGFA
  • GLIO703
  • HBGF-1
  • HBGF1
  • Fgf1
  • FGF1
  • aFGF
  • ecgf
  • fgfa
  • ecgfa
  • ecgfb
  • fgf-1
  • hbgf1
  • glio703
  • ecgf-beta
  • fgf-alpha
  • Dffrx
  • Fam
  • Fgf-1
  • Fgfa
  • zgc:136885
  • LOC100221393
  • fibroblast growth factor 1
  • fibroblast growth factor 1 L homeolog
  • fibroblast growth factor 1b
  • FGF1
  • fgf1.L
  • fgf1
  • Fgf1
  • fgf1b
  • LOC100221393
Dieser FGF1 Antikörper ist unkonjugiert
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:GEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHTDTK
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung FGF Acidic/FGF1 (FGF1 Antibody Abstract)
Hintergrund Gene Symbol: FGF1
Gen-ID 2246
Pathways RTK Signalweg, Fc-epsilon Rezeptor Signalübertragung, EGFR Signaling Pathway, Neurotrophin Signalübertragung
Applikationshinweise Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50For HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunocytochemistry/Immunofluorescence: FGF1 Antibody [NBP1-89213] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Fibroblast Growth Factor 1 (Acidic) (FGF1) antibody (ABIN4311439) Immunohistochemistry-Paraffin: FGF1 Antibody [NBP1-89213] - Staining of human kidney ...
Haben Sie etwas anderes gesucht?