Elastin (ELN) Antikörper

Details zu Produkt Nr. ABIN4307718, Anbieter: Anmelden zum Anzeigen
Antigen
  • ELN
  • SVAS
  • WBS
  • WS
  • RATTREL11
  • TREL11
  • Trela
  • Trela26
  • AI385707
  • AI480567
  • E030024M20Rik
  • elastin
  • elastin (supravalvular aortic stenosis, Williams-Beuren syndrome)
  • elastin-like
  • ELN
  • Tcur_2481
  • Kfla_2289
  • Eln
  • LOC100620140
Reaktivität
Human
69
22
19
15
14
13
5
4
3
3
3
3
1
Wirt
Kaninchen
60
29
2
1
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
3
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
59
42
30
26
15
11
10
10
8
3
2
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VKPGKVPGVGLPGVYPGGVLPGARFPGVGVLPGVPTGAGVKPKAPGVGGAFAGIPGVGPFGGPQPGVPLGYPIKAPKLPGGYGLPYTTGKLPYGYGPGGVAGAAGKAGYPTGTGVGPQAAAAAAAKAAAKFGAGA
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung Elastin (ELN Antibody Abstract)
Hintergrund Gene Symbol: ELN
Gen-ID 2006
Forschungsgebiet Extracellular Matrix, Cardiovascular
Pathways Regulation of Actin Filament Polymerization
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500For HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Elastin (ELN) antibody (ABIN4307718) Immunohistochemistry: Elastin Antibody [NBP1-80710] - Staining of human skin shows di...
Produkt verwendet in: Votteler, Berrio, Horke, Sabatier, Reinhardt, Nsair, Aikawa, Schenke-Layland: "Elastogenesis at the onset of human cardiac valve development." in: Development (Cambridge, England), Vol. 140, Issue 11, pp. 2345-53, 2013 (PubMed).

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Haben Sie etwas anderes gesucht?