Cytokine Induced Apoptosis Inhibitor 1 (CIAPIN1) Antikörper

Details zu Produkt Nr. ABIN4298735, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:92009
  • wu:fc46b12
  • CIAPIN1
  • pro0915
  • anamorsin
  • ciapin1
  • 2810413N20Rik
  • Anamorsin
  • DRE2
  • PRO0915
  • AA617265
  • AU021794
  • cytokine induced apoptosis inhibitor 1
  • Anamorsin
  • ciapin1
  • CIAPIN1
  • LOC100230873
  • cpin1
  • Ciapin1
Reaktivität
Human
71
14
10
1
Wirt
Kaninchen
46
25
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
3
3
3
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
63
35
16
10
9
5
2
1
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCL
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung CIAPIN1 (CIAPIN1 Antibody Abstract)
Hintergrund Gene Symbol: CIAPIN1
Gen-ID 57019
Forschungsgebiet Apoptosis/Necrosis, Cancer
Applikationshinweise Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Cytokine Induced Apoptosis Inhibitor 1 (CIAPIN1) antibody (ABIN4298735) Immunohistochemistry-Paraffin: CIAPIN1 Antibody [NBP1-89097] - Staining of human urin...
Western Blotting (WB) image for anti-Cytokine Induced Apoptosis Inhibitor 1 (CIAPIN1) antibody (ABIN4298735) Western Blot: CIAPIN1 Antibody [NBP1-89097] - Lane 1: Marker [kDa] 250, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Cytokine Induced Apoptosis Inhibitor 1 (CIAPIN1) antibody (ABIN4298735) Immunocytochemistry/Immunofluorescence: CIAPIN1 Antibody - Immunofluorescent stainin...
Produkt verwendet in: Nymoen, Holth, Hetland Falkenthal, Tropé, Davidson: "CIAPIN1 and ABCA13 are markers of poor survival in metastatic ovarian serous carcinoma." in: Molecular cancer, Vol. 14, pp. 44, 2015 (PubMed).

Stadler, Rexhepaj, Singan, Murphy, Pepperkok, Uhlén, Simpson, Lundberg: "Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells." in: Nature methods, Vol. 10, Issue 4, pp. 315-23, 2013 (PubMed).

Haben Sie etwas anderes gesucht?