Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) Antikörper

Details zu Produkt Nr. ABIN4279209, Anbieter: Anmelden zum Anzeigen
Antigen
  • Raldh-2
  • RALDH(II)
  • RALDH2
  • RALDH2-T
  • fb50h01
  • raldh2
  • AV116159
  • Aldh1a7
  • Raldh1
  • Raldh2
  • aldehyde dehydrogenase 1 family, member A2
  • aldehyde dehydrogenase 1 family member A2
  • aldehyde dehydrogenase family 1, subfamily A2
  • Aldh1a2
  • ALDH1A2
  • aldh1a2
Reaktivität
Human
77
62
59
3
3
3
3
3
3
3
1
1
Wirt
Kaninchen
78
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
3
3
2
2
2
2
2
2
2
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
50
26
20
17
10
2
1
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung ALDH1A2 (ALDH1A2 Antibody Abstract)
Hintergrund Gene Symbol: ALDH1A2
Molekulargewicht Theoretical MW: 57 kDa
Gen-ID 8854
UniProt O94788
Pathways Retinoic Acid Receptor Signaling Pathway
Applikationshinweise Western Blot 1:100 - 1:250, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin, HIER pH 6 retrieval is recommended. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Western Blot: ALDH1A2 Antibody [NBP1-87158] - Lane 1: Marker [kDa] 230, 130, 95, 72, ...
Immunofluorescence (IF) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunocytochemistry/Immunofluorescence: ALDH1A2 Antibody [NBP1-87158] - Staining of h...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Immunohistochemistry-Paraffin: ALDH1A2 Antibody [NBP1-87158] - Staining of human para...
Simple Western (SimWes) image for anti-Aldehyde Dehydrogenase 1 Family, Member A2 (ALDH1A2) antibody (ABIN4279209) Simple Western: ALDH1A2 Antibody [NBP1-87158] - Detection of ALDH1A2 in K562 cells us...
Produkt verwendet in: Seidensaal, Nollert, Feige, Muller, Fleming, Gunkel, Zaoui, Grabe, Weichert, Weber, Plinkert, Simon, Hess et al.: "Impaired aldehyde dehydrogenase 1 subfamily member 2A-dependent retinoic acid signaling is related with a mesenchymal-like phenotype and an unfavorable prognosis of head and neck squamous cell ..." in: Molecular cancer, Vol. 14, pp. 204, 2015 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Harper, Wiechmann, Moiseyev, Ma, Summers: "Identification of active retinaldehyde dehydrogenase isoforms in the postnatal human eye." in: PLoS ONE, Vol. 10, Issue 3, pp. e0122008, 2015 (PubMed). (Probematerial (Species): Human). Weitere Details: Western Blotting,Immunohistochemistry

Rizzardi, Rosener, Koopmeiners, Isaksson Vogel, Metzger, Forster, Marston, Tiffany, McCarthy, Turley, Warlick, Henriksen, Schmechel: "Evaluation of protein biomarkers of prostate cancer aggressiveness." in: BMC cancer, Vol. 14, pp. 244, 2014 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Kostareli, Holzinger, Bogatyrova, Hielscher, Wichmann, Keck, Lahrmann, Grabe, Flechtenmacher, Schmidt, Seiwert, Dyckhoff, Dietz, Höfler, Pawlita, Benner, Bosch, Plinkert, Plass, Weichenhan, Hess: "HPV-related methylation signature predicts survival in oropharyngeal squamous cell carcinomas." in: The Journal of clinical investigation, Vol. 123, Issue 6, pp. 2488-501, 2013 (PubMed).

Haben Sie etwas anderes gesucht?