Angiotensin II Receptor-Associated Protein (AGTRAP) Antikörper

Details zu Produkt Nr. ABIN4278739, Anbieter: Anmelden zum Anzeigen
Antigen
  • AGTRAP
  • DKFZp469M235
  • LOC100223570
  • ATRAP
  • 3300002E14Rik
  • AT1R
  • Atrap
  • D4Wsu124e
  • angiotensin II receptor-associated protein
  • angiotensin II, type I receptor-associated protein
  • AGTRAP
  • LOC100223570
  • Agtrap
Reaktivität
Human
48
8
8
Wirt
Kaninchen
38
10
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
33
30
11
4
3
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:YHMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGY
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung AGTRAP (AGTRAP Antibody Abstract)
Hintergrund Gene Symbol: AGTRAP
Gen-ID 57085
UniProt Q6RW13
Forschungsgebiet Cardiovascular
Applikationshinweise Western Blot 1:100-1:500, Immunohistochemistry 1:500-1:1000, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500-1:1000For IHC-Paraffin, HIER pH 6 retrieval method is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunofluorescence (IF) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunocytochemistry/Immunofluorescence: AGTRAP Antibody [NBP1-91654] - Staining of hu...
Immunohistochemistry (IHC) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunohistochemistry: AGTRAP Antibody [NBP1-91654] - Lane 1: Marker [kDa] 250, 130, 9...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Angiotensin II Receptor-Associated Protein (AGTRAP) antibody (ABIN4278739) Immunohistochemistry-Paraffin: AGTRAP Antibody [NBP1-91654] - Staining of human kidne...
Haben Sie etwas anderes gesucht?