Adiponectin Receptor 2 Antikörper (ADIPOR2)

Details for Product anti-ADIPOR2 Antibody No. ABIN4278486, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC84736
  • ADIPOR2
  • paqr2
  • acdcr2
  • LOC100220214
  • ACDCR2
  • PAQR2
  • 1110001I14Rik
  • ADCR2
  • AI115388
  • AW554121
  • D6Ucla1e
  • Paqr2
  • si:ch211-281k12.9
  • zgc:136273
  • adiponectin receptor 2 L homeolog
  • adiponectin receptor 2
  • adipor2.L
  • ADIPOR2
  • adipor2
  • Adipor2
Reaktivität
Human
60
27
16
3
3
3
3
2
2
2
1
1
1
1
1
1
1
1
Wirt
Kaninchen
68
7
Klonalität
Polyklonal
Konjugat
Dieser Adiponectin Receptor 2 Antikörper ist unkonjugiert
4
4
2
2
2
2
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
62
37
21
18
17
11
10
7
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CSRTPEPDIRLRKGHQLDGTRRGDNDSHQGDLEPILEASVLSSHHKKSSEEHEYSDEAPQEDEGFMGMS
Isotyp IgG
Spezifität Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Reinigung Immunogen affinity purified
Andere Bezeichnung AdipoR2 (ADIPOR2 Antibody Abstract)
Hintergrund Gene Symbol: ADIPOR2
Gen-ID 79602
Pathways AMPK Signaling
Applikationshinweise Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Adiponectin Receptor 2 (ADIPOR2) antibody (ABIN4278486) Immunohistochemistry-Paraffin: Adiponectin Receptor 2 Antibody [NBP1-91652] Staining ...
Produkt verwendet in: Guan, Zhang, Zheng, Wen, Yu, Lu, Zhao: "microRNA-423-3p promotes tumor progression via modulation of AdipoR2 in laryngeal carcinoma." in: International journal of clinical and experimental pathology, Vol. 7, Issue 9, pp. 5683-91, 2014 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry

Haben Sie etwas anderes gesucht?