DVL1 Antikörper (Dishevelled, Dsh Homolog 1 (Drosophila))

Details for Product anti-DVL1 Antibody No. ABIN4268104, Anbieter: Anmelden zum Anzeigen
  • Xdsh
  • dsh1
  • dvl-1
  • DVL
  • DVL1L1
  • DVL1P1
  • DSH
  • DVL-22
  • DVL1
  • DVL4
  • Dvl
  • mKIAA4029
  • DVL-1
  • dvl1
  • dvl2l
  • dishevelled segment polarity protein 1
  • dishevelled segment polarity protein 1 pseudogene 1
  • dishevelled, dsh homolog 1 (Drosophila)
  • dishevelled, dsh homolog 1b (Drosophila)
  • dvl1
  • Dvl1
  • DVL1
  • DVL1P1
  • dvl1b
anti-Human DVL1 Antikörper für ELISA
Dieser DVL1 Antikörper ist unkonjugiert
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren


Immunogen Synthetic peptides corresponding to DVL1(dishevelled, dsh homolog 1 (Drosophila)) The peptide sequence was selected from the middle region of DVL1. Peptide sequence LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK.
Reinigung Protein A purified
Andere Bezeichnung Dishevelled-1 (DVL1 Antibody Abstract)
Hintergrund Gene Symbol: DVL1
Gen-ID 1855
Pathways WNT Signalweg, Synaptic Membrane, Skeletal Muscle Fiber Development
Applikationshinweise Western Blot 1:100-1:2000, Immunohistochemistry-ParaffinA band is observed at ~38 kDa by Western Blot. Use in Immunohistochemistry-Paraffin reported in scientific literature (PMID 25975243)

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-DVL1 Antikörper (Dishevelled, Dsh Homolog 1 (Drosophila)) (ABIN4268104) Western Blot: Dishevelled-1 Antibody [NBP1-58317] - HepG2 cell lysate, concentration ...
Produkt verwendet in: Jung, Lee, Kim, Dhong, Cho, Roh: "Role of Wnt signaling pathway in progression of sinonasal inverted papilloma to squamous cell carcinoma." in: American journal of rhinology & allergy, Vol. 29, Issue 3, pp. e81-6, 2015 (PubMed). (Probematerial (Species): Human). Weitere Details: Immunohistochemistry (Paraffin-embedded Sections)