Cytochrome P450, Family 27, Subfamily C, Polypeptide 1 (CYP27C1) Antikörper

Details zu Produkt Nr. ABIN4266088, Anbieter: Anmelden zum Anzeigen
Antigen
  • zgc:172278
  • cytochrome P450, family 27, subfamily C, polypeptide 1
  • CYP27C1
  • cyp27c1
Reaktivität
Human
27
3
3
2
2
1
1
1
Wirt
Kaninchen
19
8
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
25
19
15
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CYP27C1(cytochrome P450, family 27, subfamily C, polypeptide 1) The peptide sequence was selected from the middle region of CYP27C1. Peptide sequence VTQEDLVIGGYLIPKGTQLALCHYATSYQDENFPRAKEFRPERWLRKGDL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CYP27C1 (CYP27C1 Antibody Abstract)
Hintergrund Gene Symbol: CYP27C1
Gen-ID 339761
UniProt Q4G0S4
Forschungsgebiet Cardiovascular
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CYP27C1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.