Cyclin J Antikörper (CCNJ) (N-Term)

Details for Product anti-CCNJ Antibody No. ABIN4265908, Anbieter: Anmelden zum Anzeigen
Antigen
  • CDI5
  • CG10308
  • Cdi5
  • Dmel\\CG10308
  • cdi5
  • cycJ
  • cyclinJ
  • MGC81420
  • ba690p14.1
  • bA690P14.1
  • D430039C20Rik
  • Cyclin J
  • cyclin J
  • cyclin J-like
  • CycJ
  • ccnj
  • CCNJ
  • CpipJ_CPIJ015384
  • CpipJ_CPIJ016049
  • Ccnj
  • CCNJL
Epitop
N-Term
10
10
8
7
4
3
1
Reaktivität
Human
36
8
6
4
3
3
3
3
1
1
1
1
Wirt
Kaninchen
32
6
Klonalität
Polyklonal
Konjugat
Dieser Cyclin J Antikörper ist unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
32
15
3
3
2
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CCNJ(cyclin J) Antibody(against the N terminal of CCNJ. Peptide sequence FMDRYDISIQQLHLVALSCLLLASKFEEKEDSVPKLEQLNSLGCMTNMNL.
Reinigung Immunogen affinity purified
Andere Bezeichnung Cyclin J
Hintergrund Gene Symbol: CCNJ
Molekulargewicht Theoretical MW: 42 kDa
Gen-ID 54619
UniProt Q5T5M9
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CCNJ and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.