Cyclin G2 Antikörper (CCNG2) (N-Term)

Details for Product anti-CCNG2 Antibody No. ABIN4265905, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC83944
  • cyclin-G2-like
  • cyclin G2
  • LOC100051425
  • ccng2
  • CCNG2
  • Ccng2
  • LOC100523979
Epitop
N-Term
15
15
10
7
4
3
3
1
1
1
Reaktivität
Human
45
19
19
2
2
Wirt
Kaninchen
41
4
Klonalität
Polyklonal
Konjugat
Dieser Cyclin G2 Antikörper ist unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
30
19
13
5
4
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the N terminal of human CCNG2. Peptide sequence MKDLGAEHLAGHEGVQLLGLLNVYLEQEERFQPREKGLSLIEATPENDNT.
Reinigung Protein A purified
Andere Bezeichnung Cyclin G2 (CCNG2 Antibody Abstract)
Hintergrund Gene Symbol: CCNG2
Molekulargewicht Theoretical MW: 39 kDa
Gen-ID 901
NCBI Accession NP_004345
Forschungsgebiet Cell Cycle, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CCNG2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Cyclin G2 (CCNG2) (N-Term) antibody (ABIN4265905) Western Blot: Cyclin G2 Antibody [NBP1-79935] - Jurkat Cell Lysate 2.5ug/ml; Gel Conc...
Western Blotting (WB) image for anti-Cyclin G2 (CCNG2) (N-Term) antibody (ABIN4265905) Western Blot: Cyclin G2 Antibody [NBP1-79935] - Sample Tissue: Human 293T Antibody Di...