CXCL13 Antikörper (Chemokine (C-X-C Motif) Ligand 13)

Details for Product anti-CXCL13 Antibody No. ABIN4265369, Anbieter: Anmelden zum Anzeigen
Antigen
  • 4631412M08Rik
  • ANGIE2
  • Angie
  • BCA-1
  • BLC
  • BLR1L
  • Scyb13
  • ANGIE
  • BCA1
  • SCYB13
  • chemokine (C-X-C motif) ligand 13
  • Cxcl13
  • CXCL13
Reaktivität
Human
120
29
6
2
1
Wirt
Kaninchen
90
34
16
13
1
1
Klonalität
Polyklonal
Konjugat
Dieser CXCL13 Antikörper ist unkonjugiert
17
9
7
5
4
4
3
3
3
3
2
2
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC)
101
53
27
25
16
14
6
4
3
2
2
2
2
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids:GVLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNGCPRKEIIVWKKNKSIVCVDPQAEWIQRMMEV
Isotyp IgG
Reinigung Immunogen affinity purified
Andere Bezeichnung CXCL13/BLC/BCA-1 (CXCL13 Antibody Abstract)
Hintergrund Gene Symbol: CXCL13
Gen-ID 10563
Applikationshinweise Immunohistochemistry 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung 4 °C,-20 °C
Informationen zur Lagerung Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Bilder des Herstellers
Immunohistochemistry (IHC) image for anti-Chemokine (C-X-C Motif) Ligand 13 (CXCL13) antibody (ABIN4265369) Immunohistochemistry: CXCL13/BLC/BCA-1 Antibody [NBP2-49054] - Staining of human bone...
Haben Sie etwas anderes gesucht?