CUEDC1 Antikörper (CUE Domain Containing 1)

Details for Product anti-CUEDC1 Antibody No. ABIN4265250, Anbieter: Anmelden zum Anzeigen
  • CUEDC1
  • AI841487
  • C330016O16Rik
  • RGD1304861
  • CUE domain containing 1
  • CUEDC1
  • cuedc1
  • Cuedc1
Dieser CUEDC1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CUEDC1(CUE domain containing 1) The peptide sequence was selected from the middle region of CUEDC1. Peptide sequence RNRDFLLALERDRLKYESQKSKSSSVAVGNDFGFSSPVPGTGDANPAVSE.
Reinigung Protein A purified
Andere Bezeichnung CUEDC1
Hintergrund Gene Symbol: CUEDC1
Gen-ID 404093
UniProt Q9NWM3
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CUEDC1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.