KIAA0427 (KIAA0427) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4265183, Anbieter: Anmelden zum Anzeigen
Antigen
  • gm672
  • kiaa0427
  • Gm672
  • KIAA0427
  • KIAA0427
  • CBP80/20-dependent translation initiation factor
  • KIAA0427
  • ctif
  • CTIF
  • Ctif
Epitop
N-Term
7
1
1
1
1
Reaktivität
Human
13
4
3
3
3
3
2
2
1
Wirt
Kaninchen
12
1
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
12
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN.
Reinigung Immunogen affinity purified
Andere Bezeichnung CTIF (KIAA0427 Antibody Abstract)
Hintergrund Gene Symbol: CTIF
Gen-ID 9811
UniProt O43310
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against KIAA0427 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.