CSN3 Antikörper (Casein kappa) (N-Term)

Details for Product anti-CSN3 Antibody No. ABIN4265158, Anbieter: Anmelden zum Anzeigen
  • CSN3
  • CSN10
  • CSNK
  • KCA
  • AW208918
  • Csnk
  • Csn10
  • Kappa-CN
  • casein kappa
  • CSN3
  • Csn3
Dieser CSN3 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CSN3 (casein kappa) The peptide sequence was selected from the N terminal of CSN3. Peptide sequence MKSFLLVVNALALTLPFLAVEVQNQKQPACHENDERPFYQKTAPYVPMYY.
Reinigung Immunogen affinity purified
Andere Bezeichnung CSN3 (CSN3 Antibody Abstract)
Hintergrund Gene Symbol: CSN3
Molekulargewicht Theoretical MW: 20 kDa
Gen-ID 1448
UniProt P07498
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSN3 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.