CSHL1 Antikörper (Chorionic Somatomammotropin Hormone-Like 1) (C-Term)

Details for Product anti-CSHL1 Antibody No. ABIN4265156, Anbieter: Anmelden zum Anzeigen
  • CSHL1
  • PL-D
  • CS-5
  • CSHP1
  • CSL
  • hCS-L
  • placental lactogen PL-D
  • chorionic somatomammotropin hormone like 1
  • PL-D
  • CSHL1
Dieser CSHL1 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CSHL1(chorionic somatomammotropin hormone-like 1) The peptide sequence was selected from the C terminal of CSHL1. Peptide sequence GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CSHL1 (CSHL1 Antibody Abstract)
Hintergrund Gene Symbol: CSHL1
Gen-ID 1444
UniProt Q14406
Forschungsgebiet Reproduction, Hormones
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSHL1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?