CHPF2 Antikörper (Chondroitin Polymerizing Factor 2) (N-Term)

Details for Product anti-CHPF2 Antibody No. ABIN4265152, Anbieter: Anmelden zum Anzeigen
  • RGD1306404
  • AW060945
  • mKIAA1402
  • 2010209O12Rik
  • CSGlcAT
  • ChSy-3
  • chondroitin polymerizing factor 2
  • Chpf2
  • CHPF2
  • chpf2
anti-Human CHPF2 Antikörper für ELISA
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CSGLCA-T The peptide sequence was selected from the N terminal of CSGLCA-T. Peptide sequence SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY.
Reinigung Immunogen affinity purified
Andere Bezeichnung CSGLCAT (CHPF2 Antibody Abstract)
Hintergrund Gene Symbol: CHPF2
Molekulargewicht Theoretical MW: 18 kDa
Gen-ID 54480
Forschungsgebiet Organelles
Pathways Glycosaminoglycan Metabolic Process
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CSGlcA-T and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.