Crystallin, beta A1 (CRYBA1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4265138, Anbieter: Anmelden zum Anzeigen
  • cryba1
  • MGC64403
  • MGC132102
  • cryb1
  • CRYB1
  • CTRCT10
  • BA3/A1
  • Cryb
  • BA3A1C
  • beta-A3
  • CRYBA3
  • zgc:92688
  • crystallin, beta A4
  • crystallin, beta A1
  • beta-crystallin A3-like
  • crystallin, beta A1a
  • cryba4
  • CRYBA1
  • cryba1
  • Cryba1
  • LOC100229047
  • LOC100519211
  • cryba1a
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CRYBA1(crystallin, beta A1) The peptide sequence was selected from the N terminal of CRYBA1. Peptide sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTS.
Reinigung Immunogen affinity purified
Andere Bezeichnung CRYBA1 (CRYBA1 Antibody Abstract)
Hintergrund Gene Symbol: CRYBA1
Gen-ID 1411
UniProt P05813
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CRYBA1 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.