Cartilage Acidic Protein 1 (CRTAC1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4265120, Anbieter: Anmelden zum Anzeigen
Antigen
  • ASPIP
  • cb184
  • crtac1
  • sb:cb184
  • zgc:165343
  • aspic1
  • cep-68
  • MGC146658
  • ASPIC
  • ASPIC1
  • CEP-68
  • 2810454P21Rik
  • AW047536
  • Crtac1B
  • Lotus
  • W307
  • cartilage acidic protein 1
  • cartilage acidic protein 1a
  • CRTAC1
  • crtac1a
  • crtac1
  • aspip
  • Crtac1
Epitop
N-Term
14
10
8
3
1
1
1
1
Reaktivität
Human
50
21
21
2
2
2
2
2
2
1
1
1
Wirt
Kaninchen
46
4
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
35
19
13
5
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CRTAC1 (cartilage acidic protein 1) The peptide sequence was selected from the N terminal of CRTAC1)(50ug). Peptide sequence FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK.
Reinigung Immunogen affinity purified
Andere Bezeichnung CRTAC1 (CRTAC1 Antibody Abstract)
Hintergrund Gene Symbol: CRTAC1
Gen-ID 55118
UniProt Q9NQ79
Forschungsgebiet Stem Cells, Extracellular Matrix
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CRTAC1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?