CREG2 Antikörper (Cellular Repressor of E1A-Stimulated Genes 2) (N-Term)

Details for Product anti-CREG2 Antibody No. ABIN4265067, Anbieter: Anmelden zum Anzeigen
  • zgc:92257
  • A830098L22Rik
  • Creg2-ps1
  • RGD1564056
  • cellular repressor of E1A-stimulated genes 2
  • cellular repressor of E1A stimulated genes 2
  • creg2
  • CREG2
  • Creg2
Dieser CREG2 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CREG2(cellular repressor of E1A-stimulated genes 2) The peptide sequence was selected from the N terminal of CREG2. Peptide sequence VSSVSWAVTNEVDEELDSASTEEAMPALLEDSGSIWQQSFPASAHKEDAH.
Reinigung Immunogen affinity purified
Andere Bezeichnung CREG2
Hintergrund Gene Symbol: CREG2
Molekulargewicht Theoretical MW: 32 kDa
Gen-ID 200407
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CREG2 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?