CREG1 Antikörper (Cellular Repressor of E1A-Stimulated Genes 1) (C-Term)

Details for Product anti-CREG1 Antibody No. ABIN4265047, Anbieter: Anmelden zum Anzeigen
Antigen
  • CREG1
  • CREG
  • AA755314
  • Creg
  • cellular repressor of E1A-stimulated genes 1
  • CREG1
  • creg1
  • Creg1
Epitop
C-Term
21
14
12
11
7
5
4
2
2
2
2
1
1
1
Reaktivität
Maus
90
62
25
4
3
3
3
2
2
1
Wirt
Kaninchen
56
40
Klonalität
Polyklonal
Konjugat
Dieser CREG1 Antikörper ist unkonjugiert
5
5
5
4
3
3
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
76
55
13
13
11
4
3
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is Creg1 - C-terminal region. Peptide sequence MMSGTVTKVNKTEEDYARDSLFVRHPEMKHWPSSHNWFFAKLKISRIWVL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CREG (CREG1 Antibody Abstract)
Hintergrund Gene Symbol: CREG1
Molekulargewicht Theoretical MW: 24 kDa
Gen-ID 8804
NCBI Accession NP_035934
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.