Creatine Kinase, Muscle (CKM) Antikörper

Details zu Produkt Nr. ABIN4265032, Anbieter: Anmelden zum Anzeigen
Antigen
  • ckmm
  • m-ck
  • CKM
  • CKMM
  • M-CK
  • Ckmm
  • MCK
  • CK-M
  • cb51
  • ckm
  • mck
  • wu:fa28d05
  • creatine kinase, muscle
  • creatine kinase, muscle a
  • ckm
  • CKM
  • Ckm
  • ckma
Reaktivität
Human
315
76
60
20
11
7
7
6
5
5
3
2
2
1
1
1
Wirt
Kaninchen
162
101
75
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
28
24
18
14
14
13
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
236
182
60
29
22
16
16
13
12
10
7
7
4
4
2
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CKM(creatine kinase, muscle) The peptide sequence was selected from the middle region of CKM. Peptide sequence GVDTAAVGSVFDVSNADRLGSSEVEQVQLVVDGVKLMVEMEKKLEKGQSI.
Reinigung Immunogen affinity purified
Andere Bezeichnung Creatine Kinase, Muscle/CKMM (CKM Antibody Abstract)
Hintergrund Gene Symbol: CKM
Molekulargewicht Theoretical MW: 43 kDa
Gen-ID 1158
UniProt P06732
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CKM and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?