Craniofacial Development Protein 1 (CFDP1) Antikörper

Details zu Produkt Nr. ABIN4265000, Anbieter: Anmelden zum Anzeigen
Antigen
  • CFDP1
  • cfdp1
  • fi15f05
  • MGC136405
  • wu:fi15f05
  • zgc:136405
  • BCNT
  • BUCENTAUR
  • CENP-29
  • CP27
  • SWC5
  • Yeti
  • p97
  • AA408409
  • Bcnt
  • Bucentaur
  • Cfdp
  • cp27
  • bcnt
  • P97
  • craniofacial development protein 1
  • si:dkey-6e12.6
  • CFDP1
  • cfdp1
  • si:dkey-6e12.6
  • CpipJ_CPIJ018830
  • LOC100282347
  • LOC100350560
  • Cfdp1
Reaktivität
Rind (Kuh), Human
75
23
22
5
5
4
4
4
2
2
2
1
Wirt
Kaninchen
46
29
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
4
3
3
3
3
3
3
3
3
3
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
62
13
4
4
4
2
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CFDP1 (craniofacial development protein 1) The peptide sequence was selected from the middle region of CFDP1. Peptide sequence GSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIH.
Reinigung Immunogen affinity purified
Andere Bezeichnung Craniofacial Development Protein 1 (CFDP1 Antibody Abstract)
Hintergrund Gene Symbol: CFDP1
Gen-ID 10428
UniProt Q9UEE9
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CFDP1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?