CPX Chromosome Region, Candidate 1 (CPXCR1) Antikörper

Details zu Produkt Nr. ABIN4264948, Anbieter: Anmelden zum Anzeigen
Antigen
  • CT77
  • Gm1143
  • CPX chromosome region, candidate 1
  • CPXCR1
  • Cpxcr1
Reaktivität
Human
35
1
Wirt
Kaninchen
25
10
Klonalität
Polyklonal
Konjugat
Unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
20
13
6
4
3
3
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the middle region of human CPXCR1. Peptide sequence WANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIV.
Reinigung Immunogen affinity purified
Andere Bezeichnung CPXCR1 (CPXCR1 Antibody Abstract)
Hintergrund Gene Symbol: CPXCR1
Gen-ID 53336
NCBI Accession NP_149037
Applikationshinweise Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500This is a rabbit polyclonal antibody against CPXCR1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.