CPNE9 Antikörper (Copine IX)

Details for Product anti-CPNE9 Antibody No. ABIN4264943, Anbieter: Anmelden zum Anzeigen
Antigen
  • A730016F12Rik
  • mKIAA4217
  • RGD1309212
  • copine family member IX
  • CPNE9
  • Cpne9
Reaktivität
Human
31
25
25
4
4
4
4
4
3
2
2
1
Wirt
Kaninchen
31
Klonalität
Polyklonal
Konjugat
Dieser CPNE9 Antikörper ist unkonjugiert
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
17
13
5
4
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CPNE9(copine family member IX) The peptide sequence was selected from the middle region of CPNE9. Peptide sequence YDRTVKIDVYDWDRDGSHDFIGEFTTSYRELSKAQNQFTVYEVLNPRKKC.
Reinigung Immunogen affinity purified
Andere Bezeichnung CPNE9 (CPNE9 Antibody Abstract)
Hintergrund Gene Symbol: CPNE9
Molekulargewicht Theoretical MW: 62 kDa
Gen-ID 151835
Applikationshinweise Western Blot 0.2-1 μg/mLThis is a rabbit polyclonal antibody against CPNE9 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?