CPN1 Antikörper (Carboxypeptidase N Subunit 1)

Details for Product anti-CPN1 Antibody No. ABIN4264937, Anbieter: Anmelden zum Anzeigen
Antigen
  • cb1037
  • fa99g08
  • wu:fa99g08
  • zgc:77485
  • cpn
  • scpn
  • CPN
  • SCPN
  • 0610011F20Rik
  • Cpn
  • AA389061
  • CPN1
  • Cyp11b
  • Cyp11b-1
  • FHI
  • carboxypeptidase N, polypeptide 1
  • cytochrome P450, family 11, subfamily b, polypeptide 1
  • cpn1
  • CPN1
  • Cpn1
  • Cyp11b1
Alternativen
anti-Human CPN1 Antikörper für ELISA
Reaktivität
Human
45
17
11
4
4
4
4
4
3
2
1
1
Wirt
Kaninchen
48
Klonalität
Polyklonal
Konjugat
Dieser CPN1 Antikörper ist unkonjugiert
3
3
Applikation
Western Blotting (WB)
46
20
13
7
4
2
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to CPN1(carboxypeptidase N, polypeptide 1) The peptide sequence was selected from the middle region of CPN1. Peptide sequence EWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGD.
Reinigung Immunogen affinity purified
Andere Bezeichnung CPN1 (CPN1 Antibody Abstract)
Hintergrund Gene Symbol: CPN1
Gen-ID 1369
UniProt P15169
Forschungsgebiet Proteolysis / Ubiquitin
Pathways Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CPN1 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.