CPEB2 Antikörper (Cytoplasmic Polyadenylation Element Binding Protein 2)

Details for Product anti-CPEB2 Antibody No. ABIN4264927, Anbieter: Anmelden zum Anzeigen
Antigen
  • cpeb2
  • CPEB2
  • DKFZp469M211
  • CPE-BP2
  • CPEB-2
  • hCPEB-2
  • A630055H10Rik
  • Cpe-bp2
  • cytoplasmic polyadenylation element binding protein 2
  • CPEB2
  • cpeb2
  • Cpeb2
Reaktivität
Human
20
12
11
6
6
4
4
4
3
3
3
3
2
1
1
1
Wirt
Kaninchen
20
Klonalität
Polyklonal
Applikation
Western Blotting (WB)
20
3
2
1
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the middle region of CPEB2. Peptide sequence DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL.
Reinigung Protein A purified
Andere Bezeichnung CPEB2 (CPEB2 Antibody Abstract)
Hintergrund Gene Symbol: CPEB2
Gen-ID 132864
Forschungsgebiet DNA/RNA, Chromatin Binding Proteins, Chromatin and Nuclear Signaling
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CPEB2 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-CPEB2 Antikörper (Cytoplasmic Polyadenylation Element Binding Protein 2) (ABIN4264927) Western Blot: CPEB2 Antibody [NBP1-57259] - Jurkat cell lysate, concentration 1.25ug/ml.