Carboxypeptidase A6 (CPA6) Antikörper

Details zu Produkt Nr. ABIN4264923, Anbieter: Anmelden zum Anzeigen
Antigen
  • MGC53632
  • CPAH
  • ETL5
  • FEB11
  • 9030616D13Rik
  • carboxypeptidase A6
  • cpa6
  • CPA6
  • SJAG_00451
  • LOC100222078
  • Cpa6
Reaktivität
Human
34
7
6
2
2
1
1
1
1
1
1
Wirt
Kaninchen
34
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
28
18
7
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptide directed towards the middle region of human CPA6The immunogen for this antibody is CPA6. Peptide sequence QSVYGVRYRYGPASTTLYVSSGSSMDWAYKNGIPYAFAFELRDTGYFGFL.
Reinigung Immunogen affinity purified
Andere Bezeichnung CPA6 (CPA6 Antibody Abstract)
Hintergrund Gene Symbol: CPA6
Molekulargewicht Theoretical MW: 51 kDa
Gen-ID 57094
NCBI Accession NP_065094
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against CPA6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.