COX7C Antikörper (Cytochrome C Oxidase Subunit VIIc) (N-Term)

Details for Product anti-COX7C Antibody No. ABIN4264919, Anbieter: Anmelden zum Anzeigen
  • Cox7c1
  • COX7C1
  • cytochrome c oxidase subunit VIIc
  • cytochrome c oxidase, subunit VIIc
  • COX7C
  • Cox7c
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is COX7C - N-terminal region. Peptide sequence SVVRRSHYEEGPGKNLPFSVENKWSLLAKMCLYFGSAFATPFLVVRHQLL.
Reinigung Immunogen affinity purified
Andere Bezeichnung COX7C (COX7C Antibody Abstract)
Hintergrund Gene Symbol: COX7C
Molekulargewicht Theoretical MW: 5 kDa
Gen-ID 1350
NCBI Accession NP_001858
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?