CORO2B Antikörper (Coronin, Actin Binding Protein, 2B) (C-Term)

Details for Product anti-CORO2B Antibody No. ABIN4264899, Anbieter: Anmelden zum Anzeigen
Antigen
  • CORO2B
  • coro2b
  • MGC89080
  • Coronin-2B
  • CLIPINC
  • E130012P22Rik
  • coronin, actin binding protein, 2B
  • coronin, actin binding protein, 2Ba
  • CORO2B
  • coro2b
  • TEgg100f23.1
  • coro2ba
  • Coro2b
Epitop
C-Term
15
10
9
8
4
2
2
1
1
1
Reaktivität
Maus
49
16
9
5
4
4
4
3
2
2
1
1
1
Wirt
Kaninchen
33
14
4
Klonalität
Polyklonal
Konjugat
Dieser CORO2B Antikörper ist unkonjugiert
3
3
3
3
3
3
Applikation
Western Blotting (WB)
33
31
9
3
3
3
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptide directed towards the C terminal of human Coro2b. Peptide sequence FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV.
Reinigung Immunogen affinity purified
Andere Bezeichnung Coronin-2B (CORO2B Antibody Abstract)
Hintergrund Gene Symbol: CORO2B
Molekulargewicht Theoretical MW: 52 kDa
Gen-ID 10391
NCBI Accession NP_780693
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Coro2b and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?