Corin Antikörper (Corin, Serine Peptidase) (C-Term)

Details for Product anti-CORIN Antibody No. ABIN4264894, Anbieter: Anmelden zum Anzeigen
Antigen
  • CORIN
  • CG2105
  • Dmel\\CG2105
  • SP75
  • LOC559109
  • AV273130
  • Lrp4
  • ATC2
  • CRN
  • PEE5
  • TMPRSS10
  • corin, serine peptidase
  • CG2105 gene product from transcript CG2105-RC
  • novel protein similar to H.sapiens CORIN, corin, serine peptidase (CORIN)
  • corin
  • CORIN
  • Corin
  • CH1073-76A20.1
  • LOC100340894
Alternativen
anti-Human Corin Antikörper für ELISA
Epitop
C-Term
15
14
9
5
4
3
3
3
3
3
2
2
2
2
1
1
1
1
1
Reaktivität
Human
59
38
25
4
4
3
3
2
2
1
Wirt
Kaninchen
64
5
2
Klonalität
Polyklonal
Konjugat
Dieser Corin Antikörper ist unkonjugiert
5
4
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
57
35
14
13
8
7
6
3
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen Synthetic peptides corresponding to CORIN(corin, serine peptidase) The peptide sequence was selected from the C terminal of CORIN. Peptide sequence HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG.
Reinigung Protein A purified
Andere Bezeichnung Corin (CORIN Antibody Abstract)
Hintergrund Gene Symbol: CORIN
Molekulargewicht Theoretical MW: 74 kDa
Gen-ID 10699
Forschungsgebiet Proteolysis / Ubiquitin, Cardiovascular, Wnt
Pathways Regulation of Systemic Arterial Blood Pressure by Hormones
Applikationshinweise Western Blot 2.5 μg/mLThis is a rabbit polyclonal antibody against CORIN and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Corin Antikörper (Corin, Serine Peptidase) (C-Term) (ABIN4264894) Western Blot: CORIN Antibody [NBP1-59663] - HepG2 cell lysate, concentration 2.5 ug/ml.