Coq7 Antikörper (Coenzyme Q Biosynthesis Protein 7) (C-Term)

Details for Product anti-Coq7 Antibody No. ABIN4264890, Anbieter: Anmelden zum Anzeigen
  • CAT5
  • CLK-1
  • CLK1
  • clk-1
  • coenzyme Q7 homolog, ubiquinone (yeast)
  • demethyl-Q 7
  • Protein CLK-1
  • COQ7
  • Coq7
  • clk-1
anti-Human Coq7 Antikörper für Cell Culture
Dieser Coq7 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen The immunogen for this antibody is COQ7 - C-terminal region. Peptide sequence MACTVAVEESIAHHYNNQIRTLMEEDPEKYEELLQLIKKFRDEELEHHDI.
Reinigung Immunogen affinity purified
Andere Bezeichnung COQ7 (Coq7 Antibody Abstract)
Hintergrund Gene Symbol: COQ7
Molekulargewicht Theoretical MW: 20 kDa
Gen-ID 10229
NCBI Accession NP_001177912
Forschungsgebiet Signaling, Metabolism
Pathways Tube Formation
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.