CPNE6 Antikörper (Copine VI)

Details for Product anti-CPNE6 Antibody No. ABIN4264884, Anbieter: Anmelden zum Anzeigen
  • CPNE6
  • AU067659
  • BB076446
  • Copine-6
  • copine-6-like
  • copine VI (neuronal)
  • copine VI
  • LOC100054951
  • CPNE6
  • Cpne6
Dieser CPNE6 Antikörper ist unkonjugiert
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The specific Immunogen is proprietary information. Peptide sequence YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE.
Reinigung Immunogen affinity purified
Andere Bezeichnung Copine-6 (CPNE6 Antibody Abstract)
Hintergrund Gene Symbol: CPNE6
Molekulargewicht Theoretical MW: 62 kDa
Gen-ID 9362
NCBI Accession NP_034077
Applikationshinweise Western Blot 1:1000This is a rabbit polyclonal antibody against Cpne6 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?