Coatomer Protein Complex Subunit gamma 1 (COPg1) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264879, Anbieter: Anmelden zum Anzeigen
Antigen
  • COPG
  • COPG2
  • AU019265
  • BC056168
  • Copg
  • D6Ertd71e
  • D6Wsu16e
  • coatomer protein complex, subunit gamma
  • coatomer protein complex, subunit gamma 1
  • COPG1
  • Copg1
Epitop
N-Term
18
11
5
2
1
1
Reaktivität
Human
37
8
8
2
2
2
2
2
1
1
1
1
1
Wirt
Kaninchen
37
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
35
18
8
3
3
2
2
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to COPG (coatomer protein complex, subunit gamma) The peptide sequence was selected from the N terminal of COPG)(50ug). Peptide sequence MLKKFDKKDEESGGGSNPFQHLEKSAVLQEARVFNETPINPRKCAHILTK.
Reinigung Immunogen affinity purified
Andere Bezeichnung COPG (COPg1 Antibody Abstract)
Hintergrund Gene Symbol: COPG1
Gen-ID 22820
UniProt Q9Y678
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against COPG and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.