GJA9 Antikörper (Gap Junction Protein, alpha 9, 59kDa)

Details for Product anti-GJA9 Antibody No. ABIN4264876, Anbieter: Anmelden zum Anzeigen
Antigen
  • CX58
  • CX59
  • GJA10
  • gap junction protein, alpha 9, 59kDa
  • GJA9
Reaktivität
Human
42
11
3
1
Wirt
Kaninchen
42
Klonalität
Polyklonal
Konjugat
Dieser GJA9 Antikörper ist unkonjugiert
4
4
4
4
4
4
Applikation
Western Blotting (WB)
32
29
26
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to GJA9(gap junction protein, alpha 9, 59kDa) The peptide sequence was selected from the middle region of GJA9. Peptide sequence IDGENNMRQSPQTVFSLPANCDWKPRWLRATWGSSTEHENRGSPPKGNLK.
Reinigung Immunogen affinity purified
Andere Bezeichnung Connexin 58/GJA9 (GJA9 Antibody Abstract)
Hintergrund Gene Symbol: GJA9
Gen-ID 81025
UniProt P57773
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GJA9 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?