Gap Junction Protein, alpha 3, 46kDa (GJA3) (N-Term) Antikörper

Details zu Produkt Nr. ABIN4264871, Anbieter: Anmelden zum Anzeigen
Antigen
  • cx46
  • MGC53082
  • czp3
  • Cx44
  • cx48.5
  • Cnx46
  • Cx43
  • Cx46
  • Gja-3
  • CTRCT14
  • CX46
  • CZP3
  • gap junction protein, alpha 3, 46kDa
  • connexin 46
  • gap junction protein, alpha 3
  • gja3
  • LOC100225310
  • GJA3
  • Gja3
Epitop
N-Term
19
11
6
6
5
2
2
1
1
1
1
1
Reaktivität
Human
51
14
14
3
2
1
1
1
Wirt
Kaninchen
56
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
Applikation
Western Blotting (WB)
44
28
26
15
4
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to GJA3(gap junction protein, alpha 3, 46kDa) The peptide sequence was selected from the N terminal of GJA3. Peptide sequence ISHIRFWALQIIFVSTPTLIYLGHVLHIVRMEEKKKEREEEEQLKRESPS.
Reinigung Immunogen affinity purified
Andere Bezeichnung Connexin 46/GJA3 (GJA3 Antibody Abstract)
Hintergrund Gene Symbol: GJA3
Gen-ID 2700
UniProt Q9Y6H8
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GJA3 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?