Gap Junction Protein, delta 2, 36kDa (GJD2) Antikörper

Details zu Produkt Nr. ABIN4264861, Anbieter: Anmelden zum Anzeigen
Antigen
  • CX36
  • GJA9
  • GJD2
  • GJA10
  • Gja9
  • connexin36
  • cx36
  • Cx36
  • Cx35.1
  • connexin-36
  • gap junction protein, delta 2, 36kDa
  • gap junction protein, delta 2
  • CX36
  • GJD2
  • LOC100220961
  • LOC100341036
  • Gjd2
Reaktivität
Human
58
37
32
6
6
5
5
5
3
2
1
1
1
1
Wirt
Kaninchen
59
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
3
3
3
2
2
2
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
47
23
20
16
13
4
3
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen Synthetic peptides corresponding to CX36 The peptide sequence was selected from the middle region of CX36. Peptide sequence NTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISRFYIIQVVFRNA.
Reinigung Protein A purified
Andere Bezeichnung Connexin 36/GJD2 (GJD2 Antibody Abstract)
Hintergrund Gene Symbol: GJD2
Molekulargewicht Theoretical MW: 35 kDa
Gen-ID 57369
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against CX36 and was validated on Western blot. The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Gap Junction Protein, delta 2, 36kDa (GJD2) antibody (ABIN4264861) Western Blot: Connexin 36/GJD2 Antibody [NBP1-70507] - Human Muscle lysate, concentra...
Haben Sie etwas anderes gesucht?