GJB6 Antikörper (Gap Junction Protein, beta 6, 30kDa)

Details for Product anti-GJB6 Antibody No. ABIN4264859, Anbieter: Anmelden zum Anzeigen
Antigen
  • connexin-26
  • cx26
  • cx30
  • dfna3
  • dfna3a
  • dfnb1
  • dfnb1a
  • ed2
  • edh
  • gjb6
  • hed
  • nsrd1
  • ppk
  • AA958971
  • Cx30
  • D14Bwg0506e
  • CX30
  • DFNA3
  • DFNA3B
  • DFNB1B
  • ECTD2
  • ED2
  • EDH
  • HED
  • HED2
  • CX31
  • connexin 30
  • gap junction protein, beta 2, 26kDa
  • gap junction protein, beta 6, 30kDa
  • gap junction protein, beta 6
  • LOC387566
  • gjb2
  • GJB6
  • Gjb6
Alternativen
anti-Human GJB6 Antikörper für ELISA
Reaktivität
Human
49
13
12
5
2
1
1
1
1
1
Wirt
Kaninchen
36
12
1
Klonalität
Polyklonal
Konjugat
Dieser GJB6 Antikörper ist unkonjugiert
3
3
3
3
3
3
Applikation
Western Blotting (WB)
35
34
23
4
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to GJB6(gap junction protein, beta 6, 30kDa) The peptide sequence was selected from the middle region of GJB6. Peptide sequence CYLLLKVCFRRSKRAQTQKNHPNHALKESKQNEMNELISDSGQNAITGFP.
Reinigung Immunogen affinity purified
Andere Bezeichnung Connexin 30/GJB6 (GJB6 Antibody Abstract)
Hintergrund Gene Symbol: GJB6
Gen-ID 10804
UniProt O95452
Pathways Sensory Perception of Sound
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against GJB6 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS & 2 % Sucrose.
Buffer contains: No Preservative
Konservierungsmittel Without preservative
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.