Complement Factor H-Related 4 (CFHR4) (C-Term) Antikörper

Details zu Produkt Nr. ABIN4264801, Anbieter: Anmelden zum Anzeigen
Antigen
  • CFHL4
  • FHR-4
  • FHR4
  • complement factor H-related 4
  • CFHR4
Epitop
C-Term
8
2
2
1
Reaktivität
Human
21
1
Wirt
Kaninchen
14
5
2
Klonalität
Polyklonal
Konjugat
Unkonjugiert
2
2
2
2
2
2
1
Applikation
Western Blotting (WB)
14
8
2
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Immunogen The immunogen for this antibody is CFHR4 - C-terminal region. Peptide sequence SNGEWSEPPRCIHPCIITEENMNKNNIQLKGKSDIKYYAKTGDTIEFMCK.
Reinigung Immunogen affinity purified
Andere Bezeichnung Complement Factor H-Related 4/CFHR4 (CFHR4 Antibody Abstract)
Hintergrund Gene Symbol: CFHR4
Molekulargewicht Theoretical MW: 63 kDa
Gen-ID 10877
NCBI Accession NP_001188480
Applikationshinweise Western Blot 1:1000The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Haben Sie etwas anderes gesucht?