Complement C2 Antikörper

Details zu Produkt Nr. ABIN4264634, Anbieter: Anmelden zum Anzeigen
Antigen
  • CO2
  • complement component 2
  • complement component 2 (within H-2S)
  • C2
Reaktivität
Human
102
26
24
12
5
4
4
3
2
2
1
1
1
1
Wirt
Kaninchen
73
28
3
Klonalität
Polyklonal
Konjugat
Unkonjugiert
4
4
4
3
3
2
1
1
1
1
1
1
1
1
1
1
1
1
Applikation
Western Blotting (WB)
69
46
13
8
8
7
5
4
4
3
2
2
2
1
1
1
Optionen
Hersteller
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen
Request

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Bilder

Immunogen Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the middle region of C2. Peptide sequence INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ.
Reinigung Protein A purified
Andere Bezeichnung Complement Component C2
Hintergrund Gene Symbol: C2
Gen-ID 717
UniProt P06681
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against C2 and was validated on Western blot.
Kommentare

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.
Bilder des Herstellers
Western Blotting (WB) image for anti-Complement C2 Antikörper (ABIN4264634) Western Blot: Complement Component C2 Antibody [NBP1-58985] - Jurkat cell lysate, con...