Complement C2 Antikörper

Details zu Produkt Nr. ABIN4264633, Anbieter: Anmelden zum Anzeigen
  • CO2
  • complement component 2
  • complement component 2 (within H-2S)
  • C2
Western Blotting (WB)
Anmelden zum Anzeigen
Hersteller Produkt- Nr.
Anmelden zum Anzeigen

Dieses Produkt umsonst

Schicken Sie uns Ihren Validierungsvorschlag. Ich möchte dieses Produkt validieren

Mehr erfahren

Immunogen Synthetic peptides corresponding to C2(complement component 2) The peptide sequence was selected from the middle region of C2. Peptide sequence INQKRNDYLDIYAIGVGKLDVDWRELNELGSKKDGERHAFILQDTKALHQ.
Reinigung Protein A purified
Andere Bezeichnung Complement Component C2
Hintergrund Gene Symbol: C2
Gen-ID 717
UniProt P06681
Applikationshinweise Western Blot 1:100-1:2000This is a rabbit polyclonal antibody against C2 and was validated on Western blot.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Beschränkungen Nur für Forschungszwecke einsetzbar
Format Liquid
Buffer PBS and 2 % Sucrose
Buffer contains: 0.09 % Sodium Azide
Konservierungsmittel Sodium azide
Vorsichtsmaßnahmen This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Lagerung -20 °C
Informationen zur Lagerung Store at -20°C. Avoid freeze-thaw cycles.